PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05576.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 416aa    MW: 47213.9 Da    PI: 6.5126
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05576.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.7e-51531782128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                              +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg
  Rsa1.0_05576.1_g00001.1  53 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATG 137
                              79***************************.89***************888889********************************* PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               d+ + s++++ +glkktLvfy+g+apkg++t+W+m+eyrl
  Rsa1.0_05576.1_g00001.1 138 ADRMIRSETSRPIGLKKTLVFYSGKAPKGTRTSWIMNEYRL 178
                              ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.19E-5652199IPR003441NAC domain
PROSITE profilePS5100556.27252199IPR003441NAC domain
PfamPF023653.0E-2554178IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MAIVSSTTSL TTMSNQVNNN NEKDIEEDTH GGGHESRARN DDEADDHDHD MVMPGFRFHP  60
TEEELIEFYL RRKVEGKRFN VELITFLDLY RYDPWELPAM AAIGEKEWYF YVPRDRKYRN  120
GDRPNRVTTS GYWKATGADR MIRSETSRPI GLKKTLVFYS GKAPKGTRTS WIMNEYRLPH  180
HETEKYQKAE ISLCRVYKRP GVEDHPSLPR SLSTRHHNHN SASSSSRLAL RQQQQHHSSS  240
SNHSDNNLNN NSNNNISNNL DKLSTEYSGD GSTTTTTNSN SDVTIALANQ NIYRPMPYGA  300
SNTPIVSTTN QEDDETAIVD DLQRLVNYQI SDGVNINHQY YQIAQQFHNQ QLSANANALQ  360
LVAAATTAAL TPQTQAALAM NMIPAGTIPN NPLWDMWNPL VPDHGNKDHY TDTPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-57431998165NO APICAL MERISTEM PROTEIN
1ut4_B5e-57431998165NO APICAL MERISTEM PROTEIN
1ut7_A5e-57431998165NO APICAL MERISTEM PROTEIN
1ut7_B5e-57431998165NO APICAL MERISTEM PROTEIN
3swm_A6e-574319911168NAC domain-containing protein 19
3swm_B6e-574319911168NAC domain-containing protein 19
3swm_C6e-574319911168NAC domain-containing protein 19
3swm_D6e-574319911168NAC domain-containing protein 19
3swp_A6e-574319911168NAC domain-containing protein 19
3swp_B6e-574319911168NAC domain-containing protein 19
3swp_C6e-574319911168NAC domain-containing protein 19
3swp_D6e-574319911168NAC domain-containing protein 19
4dul_A5e-57431998165NAC domain-containing protein 19
4dul_B5e-57431998165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0008740.0BT000874.1 Arabidopsis thaliana clone C104984 putative NAM (no apical meristem) protein (At2g02450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009101257.10.0PREDICTED: NAC domain-containing protein 19-like
TrEMBLM4E7R20.0M4E7R2_BRARP; Uncharacterized protein
STRINGBra024818.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54362750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.20.0NAC domain containing protein 35